| Product Number |
ARP50861_P050 |
| Product Page |
www.avivasysbio.com/smyd1-antibody-n-terminal-region-arp50861-p050.html |
| Name |
SMYD1 Antibody - N-terminal region (ARP50861_P050) |
| Protein Size (# AA) |
490 amino acids |
| Molecular Weight |
56kDa |
| NCBI Gene Id |
150572 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
SET and MYND domain containing 1 |
| Alias Symbols |
BOP, KMT3D, ZMYND18, ZMYND22 |
| Peptide Sequence |
Synthetic peptide located within the following region: AARIMWRVEREGTGLTEGCLVSVDDLQNHVEHFGEEEQKDLRVDVDTFLQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Sims,R.J. (2002) J. Biol. Chem. 277 (29), 26524-26529 |
| Description of Target |
SMYD1 acts as a transcriptional repressor. SMYD1 is essential for cardiomyocyte differentiation and cardiac morphogenesis. |
| Protein Interactions |
HOMEZ; ZBTB44; BHLHE40; TTC33; UTP14A; ADSS; CCDC113; H3F3C; C11orf53; LENG8; RBM4B; WDR77; FAM204A; MYH7B; C11orf16; OGDHL; HDAC3; HDAC2; NACA; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SMYD1 (ARP50861_P050) antibody |
| Blocking Peptide |
For anti-SMYD1 (ARP50861_P050) antibody is Catalog # AAP50861 (Previous Catalog # AAPS26606) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SMYD1 |
| Uniprot ID |
Q8NB12 |
| Protein Name |
SET and MYND domain-containing protein 1 |
| Protein Accession # |
NP_938015 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_198274 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SMYD1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100% |
| Image 1 | Human ACHN
 | WB Suggested Anti-SMYD1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: ACHN cell lysate |
|
