WDFY3 Antibody - middle region (ARP50849_P050)

Data Sheet
 
Product Number ARP50849_P050
Product Page www.avivasysbio.com/wdfy3-antibody-middle-region-arp50849-p050.html
Name WDFY3 Antibody - middle region (ARP50849_P050)
Protein Size (# AA) 795 amino acids
Molecular Weight 90kDa
NCBI Gene Id 23001
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name WD repeat and FYVE domain containing 3
Alias Symbols ALFY, BCHS, MCPH18, ZFYVE25
Peptide Sequence Synthetic peptide located within the following region: LEVMVNLLHKYAALLKDPTQALNEQGDSRNNSSVEDQKHLALLVMETLTV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Hillier,L.W., (2005) Nature 434 (7034), 724-731
Description of Target WDFY3 is a protein which contains WD repeats and an FYVE domain. WDFY3 might target cytosolic protein aggregates for autophagic degradation.Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.This gene encodes a protein which contains WD repeats and an FYVE domain. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.
Protein Interactions CEP76; TRIM39; ZBTB44; PRMT6; SUV39H1; PRMT1; SQSTM1; TRAF6; BAG3; EEF2K; ATG16L1; ATG5; ATG12; MAP1LC3A; UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-WDFY3 (ARP50849_P050) antibody
Blocking Peptide For anti-WDFY3 (ARP50849_P050) antibody is Catalog # AAP50849 (Previous Catalog # AAPY03404)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human WDFY3
Uniprot ID Q8IZQ1
Protein Name WD repeat and FYVE domain-containing protein 3
Protein Accession # NP_848698
Purification Affinity Purified
Nucleotide Accession # NM_178583
Tested Species Reactivity Human
Gene Symbol WDFY3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%
Image 1
Human Muscle
WB Suggested Anti-WDFY3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Muscle
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com