Myocd Antibody - N-terminal region (ARP50817_P050)

• Product Number: ARP50817_P050
• Name: Myocd Antibody - N-terminal region (ARP50817_P050)
• Protein Size (# AA): 983 amino acids
• Molecular Weight: 106kDa
• NCBI Gene Id: 214384
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: myocardin
• Alias Symbols: Sr, Srfcp, BSAC2A
• Peptide Sequence: Synthetic peptide located within the following region: KSLGDSKNRHKKPKDPKPKVKKLKYHQYIPPDQKAEKSPPPMDSAYARLL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The function of this protein remains unknown.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-MYOCD (ARP50817_P050) antibody is Catalog # AAP50817 (Previous Catalog # AAPS29909)
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Uniprot ID: Q8VIM5
• Protein Name: Myocardin
• Protein Accession #: NP_660118
• Purification: Affinity Purified
• Nucleotide Accession #: NM_145136
• Tested Species Reactivity: Mouse
• Gene Symbol: MYOCD
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
• Image 1: Mouse Spleen
  
  Host: Mouse
  Target Name: MYOCD
  Sample Tissue: Mouse Spleen
  Antibody Dilution: 1ug/ml
• Image 2: Mouse Spleen
  
  Host: Rabbit
  Target Name: MYOCD
  Sample Tissue: Mouse Spleen
  Antibody Dilution: 1ug/ml
• Image 3: Mouse Pancreas
  
  WB Suggested Anti-Myocd Antibody
  Titration: 1.0 ug/ml
  Positive Control: Mouse Pancreas