| Product Number |
ARP50721_P050 |
| Product Page |
www.avivasysbio.com/zmat1-antibody-middle-region-arp50721-p050.html |
| Name |
ZMAT1 Antibody - middle region (ARP50721_P050) |
| Protein Size (# AA) |
467 amino acids |
| Molecular Weight |
55kDa |
| NCBI Gene Id |
84460 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger, matrin-type 1 |
| Alias Symbols |
KIAA1789, MGC176728 |
| Peptide Sequence |
Synthetic peptide located within the following region: RMCEQRFSHEASQTYQRPYHISPVESQLPQWLPTHSKRTYDSFQDELEDY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of ZMAT1 has not been determined. |
| Protein Interactions |
LZTS2; GORASP2; BLZF1; ALAS1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZMAT1 (ARP50721_P050) antibody |
| Blocking Peptide |
For anti-ZMAT1 (ARP50721_P050) antibody is Catalog # AAP50721 (Previous Catalog # AAPP43832) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZMAT1 |
| Uniprot ID |
A7MD47 |
| Protein Name |
ZMAT1 protein EMBL AAI40921.1 |
| Protein Accession # |
NP_115817 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_032441 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZMAT1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 92%; Rat: 92% |
| Image 1 | Human HepG2
 | WB Suggested Anti-ZMAT1 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate |
|
|
