Product Number |
ARP50643_P050 |
Product Page |
www.avivasysbio.com/nrip3-antibody-middle-region-arp50643-p050.html |
Name |
NRIP3 Antibody - middle region (ARP50643_P050) |
Protein Size (# AA) |
241 amino acids |
Molecular Weight |
27kDa |
NCBI Gene Id |
56675 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Nuclear receptor interacting protein 3 |
Alias Symbols |
C11orf14, NY-SAR-105 |
Peptide Sequence |
Synthetic peptide located within the following region: EKNLSLGLQTLRSLKCIINLDKHRLIMGKTDKEEIPFVETVSLNEDNTSE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Lee,S.Y., (2003) Proc. Natl. Acad. Sci. U.S.A. 100 (5), 2651-2656 |
Description of Target |
The exact functions of NRIP3 remain unknown. |
Protein Interactions |
CCDC155; CFTR; ELAVL1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-NRIP3 (ARP50643_P050) antibody |
Blocking Peptide |
For anti-NRIP3 (ARP50643_P050) antibody is Catalog # AAP50643 (Previous Catalog # AAPY03380) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human NRIP3 |
Uniprot ID |
Q9NQ35 |
Protein Name |
Nuclear receptor-interacting protein 3 |
Sample Type Confirmation |
NRIP3 is supported by BioGPS gene expression data to be expressed in PANC1 |
Protein Accession # |
NP_065696 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_020645 |
Tested Species Reactivity |
Human |
Gene Symbol |
NRIP3 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100% |
Image 1 | Human PANC1
| WB Suggested Anti-NRIP3 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: PANC1 cell lysateNRIP3 is supported by BioGPS gene expression data to be expressed in PANC1 |
|
|