| Product Number |
ARP50299_P050 |
| Product Page |
www.avivasysbio.com/tmem132d-antibody-middle-region-arp50299-p050.html |
| Name |
Tmem132d Antibody - middle region (ARP50299_P050) |
| Protein Size (# AA) |
1097 amino acids |
| Molecular Weight |
121kDa |
| NCBI Gene Id |
243274 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Transmembrane protein 132D |
| Alias Symbols |
C630028F04Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: QRPKQEAAISCWVQFSDGSVTPLDIYDEKDFSLMATSLDEKVVSILQDPK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Tmem132d may serve as a cell-surface marker for oligodendrocyte differentiation. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Tmem132d (ARP50299_P050) antibody |
| Blocking Peptide |
For anti-Tmem132d (ARP50299_P050) antibody is Catalog # AAP50299 (Previous Catalog # AAPS29109) |
| Uniprot ID |
Q76HP3 |
| Protein Name |
Transmembrane protein 132D |
| Protein Accession # |
NP_766473 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_172885 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Tmem132d |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
| Image 1 | Mouse Liver
 | WB Suggested Anti-Tmem132d Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Liver |
|
|
