| Product Number |
ARP50078_P050 |
| Product Page |
www.avivasysbio.com/st6gal2-antibody-c-terminal-region-arp50078-p050.html |
| Name |
St6gal2 Antibody - C-terminal region (ARP50078_P050) |
| Protein Size (# AA) |
438 amino acids |
| Molecular Weight |
50kDa |
| NCBI Gene Id |
240119 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Beta galactoside alpha 2,6 sialyltransferase 2 |
| Alias Symbols |
St6galII, mKIAA1877, C230064G14Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: RGLSSCAVVMSAGAILNSSLGEEIDSHDAVLRFNSAPTRGYEKDVGNKTT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-St6gal2 (ARP50078_P050) antibody |
| Blocking Peptide |
For anti-St6gal2 (ARP50078_P050) antibody is Catalog # AAP50078 (Previous Catalog # AAPP13417) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
B2RQY9 |
| Protein Name |
Beta galactoside alpha 2,6 sialyltransferase 2 EMBL AAI38143.1 |
| Protein Accession # |
NP_766417 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_172829 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
St6gal2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
| Image 1 | Mouse Small Intestine
 | WB Suggested Anti-St6gal2 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Small Intestine |
|
|
