UNC84A Antibody - N-terminal region (ARP49929_P050)

• Product Number: ARP49929_P050
• Name: UNC84A Antibody - N-terminal region (ARP49929_P050)
• Protein Size (# AA): 812 amino acids
• Molecular Weight: 90kDa
• NCBI Gene Id: 23353
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Sad1 and UNC84 domain containing 1
• Alias Symbols: UNC84A
• Peptide Sequence: Synthetic peptide located within the following region: QDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGNKAAIQGNGDVGA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Chi,Y.H., (2007) J. Biol. Chem. 282 (37), 27447-27458
• Description of Target: UNC84A is a a nuclear nuclear envelope protein with an Unc84 (SUN) domain. The protein is involved in nuclear anchorage and migration.This gene is a member of the unc-84 homolog family and encodes a nuclear nuclear envelope protein with an Unc84 (SUN) domain. The protein is involved in nuclear anchorage and migration. Several alternatively spliced transcript variants of this gene have been described; however, the full-length nature of some of these variants has not been determined.
• Protein Interactions: UBC; SUMO1; NEDD8; FBXO6; env; SYNE1; SYNE2; TSNAX;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-SUN1 (ARP49929_P050) antibody is Catalog # AAP49929 (Previous Catalog # AAPY02767)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human UNC84A
• Uniprot ID: O94901
• Protein Name: SUN domain-containing protein 1
• Protein Accession #: NP_079430
• Purification: Affinity Purified
• Nucleotide Accession #: NM_025154
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: SUN1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 75%; Rat: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-UNC84A Antibody Titration: 0.2-1 ug/ml
  Positive Control: Jurkat cell lysate
• Image 2: Mouse C2C12
  
  Sample Type:
  Mouse C2C12 cells
  Primary Antibody Dilution:
  1:500
  Secondary Antibody:
  Goat anti-rabbit-Alexa Fluor 488
  Secondary Antibody Dilution:
  1:500
  Color/Signal Descriptions:
  UNC84a: Green DAPI: Blue
  Gene Name:
  UNC84A
  Submitted by:
  Dr. David Razafsky, Washington University in Saint Louis
• Image 3: Human Fetal Lung
  
  Host: Rabbit
  Target Name: UNC84A
  Sample Type: Human Fetal Lung
  Antibody Dilution: 1.0ug/ml
• Image 4: Human Adult Placenta
  
  Host: Rabbit
  Target Name: UNC84A
  Sample Type: Human Adult Placenta
  Antibody Dilution: 1.0ug/ml
• Image 5: Human HCT116 Whole Cell
  
  Host: Rabbit
  Target Name: SUN1
  Sample Tissue: Human HCT116 Whole Cell
  Antibody Dilution: 1ug/ml
• Image 6: Human HCT116 Whole Cell
  
  Host: Rabbit
  Target Name: SUN1
  Sample Tissue: Human HCT116 Whole Cell
  Antibody Dilution: 1ug/ml
• Image 7: Human Jurkat Whole Cell
  
  Host: Rabbit
  Target Name: SUN1
  Sample Type: Jurkat Whole Cell lysates
  Antibody Dilution: 3ug/ml