| Product Number |
ARP49871_P050 |
| Product Page |
www.avivasysbio.com/zdhhc11-antibody-middle-region-arp49871-p050.html |
| Name |
Zdhhc11 Antibody - middle region (ARP49871_P050) |
| Protein Size (# AA) |
352 amino acids |
| Molecular Weight |
40kDa |
| NCBI Gene Id |
499000 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger, DHHC-type containing 11 |
| Alias Symbols |
Znf399, Zdhhc20 |
| Peptide Sequence |
Synthetic peptide located within the following region: TIDPADTNVRLKKDYLEPVPTFDRSKHAHVIQNQYCHLCEVTVSKKAKHC |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Zdhhc11 (ARP49871_P050) antibody |
| Blocking Peptide |
For anti-Zdhhc11 (ARP49871_P050) antibody is Catalog # AAP49871 (Previous Catalog # AAPp29523) |
| Uniprot ID |
Q2TGJ8 |
| Protein Name |
Membrane-associated DHHC11 zinc finger protein EMBL AAX73389.1 |
| Protein Accession # |
NP_001034431 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001039342 |
| Tested Species Reactivity |
Rat |
| Gene Symbol |
Zdhhc11 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 79%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 75%; Rat: 93%; Zebrafish: 83% |
| Image 1 | Rat Muscle
 | WB Suggested Anti-Zdhhc11 Antibody
Titration: 1.0 ug/ml
Positive Control: Rat Muscle |
|
|
