ACBD4 Antibody - N-terminal region (ARP49858_P050)

• Product Number: ARP49858_P050
• Name: ACBD4 Antibody - N-terminal region (ARP49858_P050)
• Protein Size (# AA): 305 amino acids
• Molecular Weight: 35kDa
• NCBI Gene Id: 79777
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Acyl-CoA binding domain containing 4
• Alias Symbols: HMFT0700
• Peptide Sequence: Synthetic peptide located within the following region: NSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVI
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Yamada,S., (2004) Oncogene 23 (35), 5901-5911
• Description of Target: ACBD4 is a member of the acyl-coenzyme A binding domain containing protein family. All family members contain the conserved acyl-Coenzyme A binding domain, which binds acyl-CoA thiol esters. They are thought to play roles in acyl-CoA dependent lipid metabolism.
• Protein Interactions: APP;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ACBD4 (ARP49858_P050) antibody is Catalog # AAP49858 (Previous Catalog # AAPY02729)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACBD4
• Uniprot ID: Q8NC06
• Protein Name: Acyl-CoA-binding domain-containing protein 4
• Protein Accession #: NP_078998
• Purification: Affinity Purified
• Nucleotide Accession #: NM_024722
• Tested Species Reactivity: Human
• Gene Symbol: ACBD4
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human MCF-7
  
  WB Suggested Anti-ACBD4 Antibody Titration: 0.2-1 ug/ml
  Positive Control: MCF7 cell lysate