| Product Number |
ARP49844_P050 |
| Product Page |
www.avivasysbio.com/gal3st4-antibody-c-terminal-region-arp49844-p050.html |
| Name |
Gal3st4 Antibody - C-terminal region (ARP49844_P050) |
| Protein Size (# AA) |
480 amino acids |
| Molecular Weight |
54kDa |
| NCBI Gene Id |
330217 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Galactose-3-O-sulfotransferase 4 |
| Alias Symbols |
1500031A01Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: RPLQFGSAKVLGYVLQSGLNQKDKEECERLATPELQYKDKLDAKQFPPTV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Gal3st4 (ARP49844_P050) antibody |
| Blocking Peptide |
For anti-Gal3st4 (ARP49844_P050) antibody is Catalog # AAP49844 (Previous Catalog # AAPP29394) |
| Uniprot ID |
Q3V1B8 |
| Protein Name |
MCG7443, isoform CRA_a EMBL EDL19198.1 |
| Protein Accession # |
NP_001028588 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001033416 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Gal3st4 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Mouse Pancreas
 | WB Suggested Anti-Gal3st4 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Pancreas |
|
|
