Product Number |
ARP49789_P050 |
Product Page |
www.avivasysbio.com/cyp4f12-antibody-c-terminal-region-arp49789-p050.html |
Name |
CYP4F12 Antibody - C-terminal region (ARP49789_P050) |
Protein Size (# AA) |
524 amino acids |
Molecular Weight |
60kDa |
NCBI Gene Id |
66002 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Cytochrome P450, family 4, subfamily F, polypeptide 12 |
Alias Symbols |
CYPIVF12, F22329_1 |
Peptide Sequence |
Synthetic peptide located within the following region: TVWPDPEVYDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAEMKVV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Dhar,M., (2008) J. Lipid Res. 49 (3), 612-624 |
Description of Target |
CYP4F12 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. Tt likely localizes to the endoplasmic reticulum. When expressed in yeast the enzyme is capable of oxdizing arachidonic acid; however, its physiological function has not been determined. This gene is part of a cluster of cytochrome P450 genes on chromosome 19. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein likely localizes to the endoplasmic reticulum. When expressed in yeast the enzyme is capable of oxdizing arachidonic acid; however, its physiological function has not been determined. This gene is part of a cluster of cytochrome P450 genes on chromosome 19. |
Protein Interactions |
SOD2; HSPA6; UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CYP4F12 (ARP49789_P050) antibody |
Blocking Peptide |
For anti-CYP4F12 (ARP49789_P050) antibody is Catalog # AAP49789 (Previous Catalog # AAPP29361) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human CYP4F12 |
Uniprot ID |
Q9HCS2 |
Protein Name |
Cytochrome P450 4F12 |
Protein Accession # |
NP_076433 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_023944 |
Tested Species Reactivity |
Human |
Gene Symbol |
CYP4F12 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 79%; Rat: 93%; Sheep: 86% |
Image 1 | Human Placenta
| WB Suggested Anti-CYP4F12 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human Placenta |
|
|