CYP4F12 Antibody - C-terminal region (ARP49789_P050)

Data Sheet
 
Product Number ARP49789_P050
Product Page www.avivasysbio.com/cyp4f12-antibody-c-terminal-region-arp49789-p050.html
Name CYP4F12 Antibody - C-terminal region (ARP49789_P050)
Protein Size (# AA) 524 amino acids
Molecular Weight 60kDa
NCBI Gene Id 66002
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Cytochrome P450, family 4, subfamily F, polypeptide 12
Alias Symbols CYPIVF12, F22329_1
Peptide Sequence Synthetic peptide located within the following region: TVWPDPEVYDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAEMKVV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Dhar,M., (2008) J. Lipid Res. 49 (3), 612-624
Description of Target CYP4F12 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. Tt likely localizes to the endoplasmic reticulum. When expressed in yeast the enzyme is capable of oxdizing arachidonic acid; however, its physiological function has not been determined. This gene is part of a cluster of cytochrome P450 genes on chromosome 19. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein likely localizes to the endoplasmic reticulum. When expressed in yeast the enzyme is capable of oxdizing arachidonic acid; however, its physiological function has not been determined. This gene is part of a cluster of cytochrome P450 genes on chromosome 19.
Protein Interactions SOD2; HSPA6; UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CYP4F12 (ARP49789_P050) antibody
Blocking Peptide For anti-CYP4F12 (ARP49789_P050) antibody is Catalog # AAP49789 (Previous Catalog # AAPP29361)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CYP4F12
Uniprot ID Q9HCS2
Protein Name Cytochrome P450 4F12
Protein Accession # NP_076433
Purification Affinity Purified
Nucleotide Accession # NM_023944
Tested Species Reactivity Human
Gene Symbol CYP4F12
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 79%; Rat: 93%; Sheep: 86%
Image 1
Human Placenta
WB Suggested Anti-CYP4F12 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Placenta
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com