| Product Number |
ARP49712_P050 |
| Product Page |
www.avivasysbio.com/dnajc1-antibody-c-terminal-region-arp49712-p050.html |
| Name |
DNAJC1 Antibody - C-terminal region (ARP49712_P050) |
| Protein Size (# AA) |
554 amino acids |
| Molecular Weight |
64kDa |
| NCBI Gene Id |
64215 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
DnaJ (Hsp40) homolog, subfamily C, member 1 |
| Alias Symbols |
HTJ1, MTJ1, ERdj1, DNAJL1 |
| Peptide Sequence |
Synthetic peptide located within the following region: ELALQQYPRGSSDRWDKIARCVPSKSKEDCIARYKLLVELVQKKKQAKS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Kroczynska,B., (2005) Biochem. Biophys. Res. Commun. 338 (3), 1467-1477 |
| Description of Target |
DNAJC1 contains 1 J domain and 2 SANT domains. The exact function of DNAJC1 remains unknown. |
| Protein Interactions |
UBC; LMNA; ABHD16A; ITIH4; HSPA5; SERPINA3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-DNAJC1 (ARP49712_P050) antibody |
| Blocking Peptide |
For anti-DNAJC1 (ARP49712_P050) antibody is Catalog # AAP49712 (Previous Catalog # AAPP29293) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human DNAJC1 |
| Uniprot ID |
Q96KC8 |
| Protein Name |
DnaJ homolog subfamily C member 1 |
| Sample Type Confirmation |
DNAJC1 is supported by BioGPS gene expression data to be expressed in MCF7 |
| Protein Accession # |
NP_071760 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_022365 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
DNAJC1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human MCF-7
 | WB Suggested Anti-DNAJC1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysateDNAJC1 is supported by BioGPS gene expression data to be expressed in MCF7 |
|
