DNAJC1 Antibody - middle region (ARP49711_P050)

Data Sheet
 
Product Number ARP49711_P050
Product Page www.avivasysbio.com/dnajc1-antibody-middle-region-arp49711-p050.html
Name DNAJC1 Antibody - middle region (ARP49711_P050)
Protein Size (# AA) 554 amino acids
Molecular Weight 64kDa
NCBI Gene Id 64215
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name DnaJ (Hsp40) homolog, subfamily C, member 1
Alias Symbols HTJ1, MTJ1, ERdj1, DNAJL1
Peptide Sequence Synthetic peptide located within the following region: QWHDLLPCKLGIWFCLTLKALPHLIQDAGQFYAKYKETRLKEKEDALTRT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kroczynska,B., (2005) Biochem. Biophys. Res. Commun. 338 (3), 1467-1477
Description of Target DNAJC1 contains 1 J domain and 2 SANT domains. The exact function of DNAJC1 remains unknown.
Protein Interactions UBC; LMNA; ABHD16A; ITIH4; HSPA5; SERPINA3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DNAJC1 (ARP49711_P050) antibody
Blocking Peptide For anti-DNAJC1 (ARP49711_P050) antibody is Catalog # AAP49711 (Previous Catalog # AAPP29292)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human DNAJC1
Uniprot ID Q96KC8
Protein Name DnaJ homolog subfamily C member 1
Sample Type Confirmation

DNAJC1 is supported by BioGPS gene expression data to be expressed in HeLa

Protein Accession # NP_071760
Purification Affinity Purified
Nucleotide Accession # NM_022365
Tested Species Reactivity Human
Gene Symbol DNAJC1
Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human HeLa
WB Suggested Anti-DNAJC1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysateDNAJC1 is supported by BioGPS gene expression data to be expressed in HeLa
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com