Product Number |
ARP49711_P050 |
Product Page |
www.avivasysbio.com/dnajc1-antibody-middle-region-arp49711-p050.html |
Name |
DNAJC1 Antibody - middle region (ARP49711_P050) |
Protein Size (# AA) |
554 amino acids |
Molecular Weight |
64kDa |
NCBI Gene Id |
64215 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
DnaJ (Hsp40) homolog, subfamily C, member 1 |
Alias Symbols |
HTJ1, MTJ1, ERdj1, DNAJL1 |
Peptide Sequence |
Synthetic peptide located within the following region: QWHDLLPCKLGIWFCLTLKALPHLIQDAGQFYAKYKETRLKEKEDALTRT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Kroczynska,B., (2005) Biochem. Biophys. Res. Commun. 338 (3), 1467-1477 |
Description of Target |
DNAJC1 contains 1 J domain and 2 SANT domains. The exact function of DNAJC1 remains unknown. |
Protein Interactions |
UBC; LMNA; ABHD16A; ITIH4; HSPA5; SERPINA3; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-DNAJC1 (ARP49711_P050) antibody |
Blocking Peptide |
For anti-DNAJC1 (ARP49711_P050) antibody is Catalog # AAP49711 (Previous Catalog # AAPP29292) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human DNAJC1 |
Uniprot ID |
Q96KC8 |
Protein Name |
DnaJ homolog subfamily C member 1 |
Sample Type Confirmation |
DNAJC1 is supported by BioGPS gene expression data to be expressed in HeLa |
Protein Accession # |
NP_071760 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_022365 |
Tested Species Reactivity |
Human |
Gene Symbol |
DNAJC1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human HeLa
| WB Suggested Anti-DNAJC1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Hela cell lysateDNAJC1 is supported by BioGPS gene expression data to be expressed in HeLa |
|