| Product Number |
ARP49685_P050 |
| Product Page |
www.avivasysbio.com/galnt11-antibody-n-terminal-region-arp49685-p050.html |
| Name |
Galnt11 Antibody - N-terminal region (ARP49685_P050) |
| Protein Size (# AA) |
608 amino acids |
| Molecular Weight |
69kDa |
| NCBI Gene Id |
311952 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 11 (GalNAc-T11) |
| Alias Symbols |
Galnt11 |
| Peptide Sequence |
Synthetic peptide located within the following region: LGMIFNERDQELRDLGYQKHAFNMLISNRLGYHRDVPDTRNAECRRKSYP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of Galnt11 remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Galnt11 (ARP49685_P050) antibody |
| Blocking Peptide |
For anti-Galnt11 (ARP49685_P050) antibody is Catalog # AAP49685 (Previous Catalog # AAPP29266) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Rat |
| Uniprot ID |
Q921L8 |
| Protein Name |
Polypeptide N-acetylgalactosaminyltransferase 11 |
| Protein Accession # |
NP_955425 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_199393 |
| Tested Species Reactivity |
Rat |
| Gene Symbol |
Galnt11 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Rat Heart
 | WB Suggested Anti-Galnt11 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Rat Heart |
|
|
