Abo Antibody - middle region (ARP49519_P050)

Data Sheet
 
Product Number ARP49519_P050
Product Page www.avivasysbio.com/abo-antibody-middle-region-arp49519-p050.html
Name Abo Antibody - middle region (ARP49519_P050)
Protein Size (# AA) 332 amino acids
Molecular Weight 39kDa
NCBI Gene Id 80908
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase, transferase B, alpha 1-3-galactosyltransferase)
Alias Symbols NAGAT
Peptide Sequence Synthetic peptide located within the following region: GVEILSTFFGTLHPGFYSSSREAFTYERRPQSQAYIPWDRGDFYYGGAFF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function of this protein remains unknown.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Abo (ARP49519_P050) antibody
Blocking Peptide For anti-Abo (ARP49519_P050) antibody is Catalog # AAP49519 (Previous Catalog # AAPS25406)
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse
Uniprot ID P38649
Protein Name Histo-blood group ABO system transferase
Protein Accession # NP_109643
Purification Affinity Purified
Nucleotide Accession # NM_030718
Tested Species Reactivity Mouse
Gene Symbol Abo
Predicted Species Reactivity Human, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%; Rat: 100%
Image 1
Mouse Spleen
WB Suggested Anti-Abo Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Spleen
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com