Product Number |
ARP49519_P050 |
Product Page |
www.avivasysbio.com/abo-antibody-middle-region-arp49519-p050.html |
Name |
Abo Antibody - middle region (ARP49519_P050) |
Protein Size (# AA) |
332 amino acids |
Molecular Weight |
39kDa |
NCBI Gene Id |
80908 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase, transferase B, alpha 1-3-galactosyltransferase) |
Alias Symbols |
NAGAT |
Peptide Sequence |
Synthetic peptide located within the following region: GVEILSTFFGTLHPGFYSSSREAFTYERRPQSQAYIPWDRGDFYYGGAFF |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function of this protein remains unknown. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Abo (ARP49519_P050) antibody |
Blocking Peptide |
For anti-Abo (ARP49519_P050) antibody is Catalog # AAP49519 (Previous Catalog # AAPS25406) |
Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
Uniprot ID |
P38649 |
Protein Name |
Histo-blood group ABO system transferase |
Protein Accession # |
NP_109643 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_030718 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
Abo |
Predicted Species Reactivity |
Human, Rat |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100%; Rat: 100% |
Image 1 | Mouse Spleen
| WB Suggested Anti-Abo Antibody Titration: 1.0 ug/ml Positive Control: Mouse Spleen |
|
|