UGCGL1 Antibody - middle region (ARP49467_P050)

Data Sheet
 
Product Number ARP49467_P050
Product Page www.avivasysbio.com/ugcgl1-antibody-middle-region-arp49467-p050.html
Name UGCGL1 Antibody - middle region (ARP49467_P050)
Protein Size (# AA) 1531 amino acids
Molecular Weight 175kDa
NCBI Gene Id 56886
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name UDP-glucose glycoprotein glucosyltransferase 1
Alias Symbols UGT1, HUGT1, UGCGL1
Peptide Sequence Synthetic peptide located within the following region: AAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQKREE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target UDP-glucose:glycoprotein glucosyltransferase (UGT) is a soluble protein of the endoplasmic reticulum (ER) that selectively reglucosylates unfolded glycoproteins, thus providing quality control for protein transport out of the ER.
Protein Interactions PCSK9; TUBGCP3; UBC; LGR4; UNC45A; NSUN2; ACTR3; PPP2R1A; PFDN1; FNTB; FBXO6; METTL23; env; TP53BP1; ALYREF; ZW10; PSMD12; PSMC1; UBXN6; CAND1; DCUN1D1; CUL1; CUL3; SIRT7; TLR9; SEP15; SUSD2; CHST12; WISP1; TNFRSF14; HLA-A; CD40;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-UGGT1 (ARP49467_P050) antibody
Blocking Peptide For anti-UGGT1 (ARP49467_P050) antibody is Catalog # AAP49467 (Previous Catalog # AAPP29186)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human UGCGL1
Uniprot ID A8KAK1
Protein Name cDNA FLJ77398, highly similar to Homo sapiens UDP-glucose ceramide glucosyltransferase-like 1, transcript variant 2, mRNA EMBL BAF85755.1
Sample Type Confirmation

UGGT1 is supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_001020948
Purification Affinity Purified
Nucleotide Accession # NM_001025777
Tested Species Reactivity Human
Gene Symbol UGGT1
Predicted Species Reactivity Human, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%; Pig: 100%
Image 1
Human HepG2
WB Suggested Anti-UGCGL1 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysateUGGT1 is supported by BioGPS gene expression data to be expressed in HepG2
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com