Ndfip2 Antibody - N-terminal region (ARP49440_P050)

Data Sheet
 
Product Number ARP49440_P050
Product Page www.avivasysbio.com/ndfip2-antibody-n-terminal-region-arp49440-p050.html
Name Ndfip2 Antibody - N-terminal region (ARP49440_P050)
Protein Size (# AA) 242 amino acids
Molecular Weight 27kDa
NCBI Gene Id 361089
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Nedd4 family interacting protein 2
Alias Symbols Ndfip2
Peptide Sequence Synthetic peptide located within the following region: YSSITVDGPTTSDADVYSEFYPVPPPYSVATSLPTYDEAEKAKAAALAAA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function of this protein remains unknown.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Ndfip2 (ARP49440_P050) antibody
Blocking Peptide For anti-Ndfip2 (ARP49440_P050) antibody is Catalog # AAP49440 (Previous Catalog # AAPP29159)
Immunogen The immunogen is a synthetic peptide corresponding to a region of Rat
Uniprot ID F1M5D2
Protein Name Protein Ndfip2 Ensembl ENSRNOP00000061958
Protein Accession # EDM02480
Purification Affinity Purified
Nucleotide Accession # NM_001108390
Tested Species Reactivity Rat
Gene Symbol Ndfip2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Rat Lung
WB Suggested Anti-Ndfip2 Antibody
Titration: 1.0 ug/ml
Positive Control: Rat Lung
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com