Product Number |
ARP49440_P050 |
Product Page |
www.avivasysbio.com/ndfip2-antibody-n-terminal-region-arp49440-p050.html |
Name |
Ndfip2 Antibody - N-terminal region (ARP49440_P050) |
Protein Size (# AA) |
242 amino acids |
Molecular Weight |
27kDa |
NCBI Gene Id |
361089 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Nedd4 family interacting protein 2 |
Alias Symbols |
Ndfip2 |
Peptide Sequence |
Synthetic peptide located within the following region: YSSITVDGPTTSDADVYSEFYPVPPPYSVATSLPTYDEAEKAKAAALAAA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function of this protein remains unknown. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Ndfip2 (ARP49440_P050) antibody |
Blocking Peptide |
For anti-Ndfip2 (ARP49440_P050) antibody is Catalog # AAP49440 (Previous Catalog # AAPP29159) |
Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Rat |
Uniprot ID |
F1M5D2 |
Protein Name |
Protein Ndfip2 Ensembl ENSRNOP00000061958 |
Protein Accession # |
EDM02480 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001108390 |
Tested Species Reactivity |
Rat |
Gene Symbol |
Ndfip2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Rat Lung
| WB Suggested Anti-Ndfip2 Antibody Titration: 1.0 ug/ml Positive Control: Rat Lung |
|
|