| Product Number |
ARP49410_P050 |
| Product Page |
www.avivasysbio.com/hla-f-antibody-n-terminal-region-arp49410-p050.html |
| Name |
HLA-F Antibody - N-terminal region (ARP49410_P050) |
| Protein Size (# AA) |
442 amino acids |
| Molecular Weight |
48kDa |
| NCBI Gene Id |
3134 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Major histocompatibility complex, class I, F |
| Description |
|
| Alias Symbols |
HLAF, CDA12, HLA-5.4, HLA-CDA12 |
| Peptide Sequence |
Synthetic peptide located within the following region: PWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMN |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
HLA-F belongs to the HLA class I heavy chain paralogues. It is a non-classical heavy chain that forms a heterodimer with a beta-2 microglobulin light chain, with the heavy chain anchored in the membrane. Unlike most other HLA heavy chains, this molecule is localized in the endoplasmic reticulum and Golgi apparatus, with a small amount present at the cell surface in some cell types. It contains a divergent peptide-binding groove, and is thought to bind a restricted subset of peptides for immune presentation. |
| Protein Interactions |
UBC; LILRB2; LILRB1; TAP1; HLA-F; B2M; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-HLA-F (ARP49410_P050) antibody |
| Blocking Peptide |
For anti-HLA-F (ARP49410_P050) antibody is Catalog # AAP49410 (Previous Catalog # AAPP29129) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human HLA-F |
| Uniprot ID |
Q5JQI8 |
| Protein Name |
HLA class I histocompatibility antigen, alpha chain F |
| Publications |
HLA-G and HLA-F protein isoform expression in breast cancer patients receiving neoadjuvant treatment. Sci Rep. 10, 15750 (2020). 32978482 |
| Protein Accession # |
NP_001091949 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001098479 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
HLA-F |
| Predicted Species Reactivity |
Human, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100%; Pig: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-HLA-F Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate |
|
| Image 2 | Human Fetal Lung
 | Host: Rabbit
Target Name: HLA-F
Sample Type: Human Fetal Lung
Antibody Dilution: 1.0ug/ml |
|
