| Product Number |
ARP49310_P050 |
| Product Page |
www.avivasysbio.com/setd5-antibody-n-terminal-region-arp49310-p050.html |
| Name |
Setd5 Antibody - N-terminal region (ARP49310_P050) |
| Protein Size (# AA) |
1446 amino acids |
| Molecular Weight |
160kDa |
| NCBI Gene Id |
297514 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
SET domain containing 5 |
| Alias Symbols |
RGD1310433 |
| Peptide Sequence |
Synthetic peptide located within the following region: ETVPTWCPCGLSQDGFLLNCDKCRGMSRGKVIRLHRRKQDNISGGDSSAT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Setd5 (ARP49310_P050) antibody |
| Blocking Peptide |
For anti-Setd5 (ARP49310_P050) antibody is Catalog # AAP49310 (Previous Catalog # AAPY02636) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Rat |
| Uniprot ID |
D4A2W7 |
| Protein Name |
Protein Setd5 Ensembl ENSRNOP00000059211 |
| Protein Accession # |
NP_001100084 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001106614 |
| Tested Species Reactivity |
Rat |
| Gene Symbol |
Setd5 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Rat Liver
 | WB Suggested Anti-Setd5 Antibody
Titration: 1.0 ug/ml
Positive Control: Rat Liver |
| | Image 2 | Rodent Rat Thymus
 | Host: Rabbit
Target Name: SETD5
Sample Tissue: Rodent Rat Thymus
Antibody Dilution: 1ug/ml |
|
|
