Product Number |
ARP49310_P050 |
Product Page |
www.avivasysbio.com/setd5-antibody-n-terminal-region-arp49310-p050.html |
Name |
Setd5 Antibody - N-terminal region (ARP49310_P050) |
Protein Size (# AA) |
1446 amino acids |
Molecular Weight |
160kDa |
NCBI Gene Id |
297514 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
SET domain containing 5 |
Alias Symbols |
RGD1310433 |
Peptide Sequence |
Synthetic peptide located within the following region: ETVPTWCPCGLSQDGFLLNCDKCRGMSRGKVIRLHRRKQDNISGGDSSAT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function of this protein remains unknown. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Setd5 (ARP49310_P050) antibody |
Blocking Peptide |
For anti-Setd5 (ARP49310_P050) antibody is Catalog # AAP49310 (Previous Catalog # AAPY02636) |
Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Rat |
Uniprot ID |
D4A2W7 |
Protein Name |
Protein Setd5 Ensembl ENSRNOP00000059211 |
Protein Accession # |
NP_001100084 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001106614 |
Tested Species Reactivity |
Rat |
Gene Symbol |
Setd5 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Rat Liver
| WB Suggested Anti-Setd5 Antibody Titration: 1.0 ug/ml Positive Control: Rat Liver |
| Image 2 | Rodent Rat Thymus
| Host: Rabbit Target Name: SETD5 Sample Tissue: Rodent Rat Thymus Antibody Dilution: 1ug/ml |
|
|