| Product Number |
ARP49248_P050 |
| Product Page |
www.avivasysbio.com/c1orf184-antibody-c-terminal-region-arp49248-p050.html |
| Name |
C1orf184 Antibody - C-terminal region (ARP49248_P050) |
| Protein Size (# AA) |
281 amino acids |
| Molecular Weight |
32kDa |
| NCBI Gene Id |
149281 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Methyltransferase like 11B |
| Alias Symbols |
NTM1B, HOMT1B, C1orf184 |
| Peptide Sequence |
Synthetic peptide located within the following region: NVAREGCILDLSDSSVTRDMDILRSLIRKSGLVVLGQEKQDGFPEQCIPV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The exact function of C1orf184 remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-METTL11B (ARP49248_P050) antibody |
| Blocking Peptide |
For anti-METTL11B (ARP49248_P050) antibody is Catalog # AAP49248 (Previous Catalog # AAPS24609) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human C1orf184 |
| Uniprot ID |
Q5VVY1 |
| Protein Name |
Alpha N-terminal protein methyltransferase 1B |
| Protein Accession # |
XP_089281 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
XM_089281 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
METTL11B |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 86%; Rabbit: 93%; Rat: 93% |
| Image 1 | Human HepG2
 | WB Suggested Anti-C1orf184 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate |
| | Image 2 | Human HepG2
 | WB Suggested Anti-C1orf184 antibody Titration: 1 ug/mL
Sample Type: Human HepG2 |
|
|
