| Product Number |
ARP49227_P050 |
| Product Page |
www.avivasysbio.com/ggt2-antibody-n-terminal-region-arp49227-p050.html |
| Name |
GGT2 Antibody - N-terminal region (ARP49227_P050) |
| Protein Size (# AA) |
569 amino acids |
| Molecular Weight |
62kDa |
| NCBI Gene Id |
728441 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Gamma-glutamyltransferase 2 |
| Alias Symbols |
GGT, GGT 2 |
| Peptide Sequence |
Synthetic peptide located within the following region: LEIGRDTLRDGGSAVDAAIAALLCVGLMNAHSMGIGVGLFLTIYNSTTGK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
GGT2 belongs to the gamma-glutamyltransferase (GGT; EC 2.3.2.2) gene family. GGT is a membrane-bound extracellular enzyme that cleaves gamma-glutamyl peptide bonds in glutathione and other peptides and transfers the gamma-glutamyl moiety to acceptors. GGT is also key to glutathione homeostasis because it provides substrates for glutathione synthesis (Heisterkamp et al., 2008 [PubMed 18357469]). |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GGT2 (ARP49227_P050) antibody |
| Blocking Peptide |
For anti-GGT2 (ARP49227_P050) antibody is Catalog # AAP49227 (Previous Catalog # AAPP44237) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human GGT2 |
| Uniprot ID |
P36268 |
| Protein Accession # |
XP_001129425 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
XM_001129425 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GGT2 |
| Predicted Species Reactivity |
Human, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Pig: 100%; Rabbit: 93%; Rat: 86%; Zebrafish: 86% |
| Image 1 | Human HeLa
 | WB Suggested Anti-GGT2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate |
|
|
