TGS1 Antibody - middle region (ARP48923_P050)

Data Sheet
 
Product Number ARP48923_P050
Product Page www.avivasysbio.com/tgs1-antibody-middle-region-arp48923-p050.html
Name TGS1 Antibody - middle region (ARP48923_P050)
Protein Size (# AA) 853 amino acids
Molecular Weight 96kDa
NCBI Gene Id 96764
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Trimethylguanosine synthase 1
Alias Symbols PIMT, PIPMT, NCOA6IP
Peptide Sequence Synthetic peptide located within the following region: IDENPASDFDDSGSLLGFKYGSGQKYGGIPNFSHRQVRYLEKNVKLKSKY
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Fanelus,I. (2008) Biochem. Biophys. Res. Commun. 371 (2), 203-208
Description of Target TGS1 catalyzes the methylation step(s) for the conversion of the 7-monomethylguanosine (m7G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure. TGS1 plays a role in transcriptional regulation.
Protein Interactions LIN28A; UBC; COIL; Nhp2l1; NCOA6; HNF4A; EP300; EED; CREBBP; SNORD3A; MED1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TGS1 (ARP48923_P050) antibody
Blocking Peptide For anti-TGS1 (ARP48923_P050) antibody is Catalog # AAP48923 (Previous Catalog # AAPP28973)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TGS1
Uniprot ID Q96RS0
Protein Name Trimethylguanosine synthase
Protein Accession # NP_079107
Purification Affinity Purified
Nucleotide Accession # NM_024831
Tested Species Reactivity Human
Gene Symbol TGS1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 92%; Guinea Pig: 93%; Horse: 85%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 93%
Image 1
Human HepG2
WB Suggested Anti-TGS1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com