SUV39H2 Antibody - middle region (ARP48910_P050)

Data Sheet
 
Product Number ARP48910_P050
Product Page www.avivasysbio.com/suv39h2-antibody-middle-region-arp48910-p050.html
Name SUV39H2 Antibody - middle region (ARP48910_P050)
Protein Size (# AA) 350 amino acids
Molecular Weight 40
NCBI Gene Id 79723
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Suppressor of variegation 3-9 homolog 2 (Drosophila)
Alias Symbols KMT1B
Peptide Sequence Synthetic peptide located within the following region: LDTRLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function of this protein remains unknown.
Protein Interactions APPL2; CBX5; PNMA1; CCDC37; C8orf74; LCA5L; ZNF57; RAB3IP; MTF2; SNF8; RASSF1; MYL12A; POLR3F; AKAP9; BLZF1; ZNF212; NME4; ID2; CCDC151; MRFAP1; LNX1; CEP70; GSTCD; KCTD17; ZNF557; WIZ; CDCA4; KLHDC4; KLF3; PHF19; FAM20C; LRIF1; MCM3AP; SHC1; CBX7; SMAD5;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SUV39H2 (ARP48910_P050) antibody
Blocking Peptide For anti-SUV39H2 (ARP48910_P050) antibody is Catalog # AAP48910 (Previous Catalog # AAPP28961)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SUV39H2
Uniprot ID D3DRT4
Protein Name Histone-lysine N-methyltransferase SUV39H2
Protein Accession # NP_078946
Purification Affinity Purified
Nucleotide Accession # NM_024670
Tested Species Reactivity Human
Gene Symbol SUV39H2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 86%
Image 1
MCF7 Cell Lysate , Human Brain
Host: Rabbit
Target: SUV39H2
Positive control (+): MCF7 Cell Lysate (N10)
Negative control (-): Human Brain (BR)
Antibody concentration: 1ug/ml
Image 2
Human HepG2
WB Suggested Anti-SUV39H2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com