| Product Number |
ARP48819_P050 |
| Product Page |
http://www.avivasysbio.com/trmu-antibody-c-terminal-region-arp48819-p050.html |
| Product Name |
TRMU antibody - C-terminal region (ARP48819_P050) |
| Size |
50ug |
| Gene Symbol |
TRMU |
| Alias Symbols |
MGC99627; MTO2; MTU1; TRMT; TRMT1; TRNT1 |
| Nucleotide Accession# |
NM_018006 |
| Protein Accession# |
NP_060476 |
| Swissprot Id |
O75648 |
| Protein Size (# AA) |
421 amino acids |
| Molecular Weight |
48kDa |
| Product Format |
Lyophilized powder |
| NCBI Gene Id |
55687 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Purification |
Affinity Purified |
| Official Gene Full Name |
TRNA 5-methylaminomethyl-2-thiouridylate methyltransferase |
| Description |
This is a rabbit polyclonal antibody against TRMU. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com). |
| Peptide Sequence |
Synthetic peptide located within the following region: ALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSP |
| Key Reference |
Guan,M.X., (2006) Am. J. Hum. Genet. 79 (2), 291-302 |
| Description of Target |
TRMU is a member of the trmU family. It is a mitochondria-specific tRNA-modifying enzyme that is required for the 2-thio modification of 5-taurinomethyl-2-thiouridine tRNA-Lys on the wobble position of the anticodon.This gene is a member of the trmU family. It encodes a mitochondria-specific tRNA-modifying enzyme that is required for the 2-thio modification of 5-taurinomethyl-2-thiouridine tRNA-Lys on the wobble position of the anticodon. |
| Partner Proteins |
GPN1, POLR3D, POLR3H, RAE1, RPAP1, RPAP2 |
| Reconstitution and Storage |
Add 50 μl of distilled water. Final anti-TRMU antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Lead Time |
Domestic: within 24 hours delivery
International: 3-5 business days |
| Blocking Peptide |
For anti-TRMU antibody is Catalog # AAP48819 (Previous Catalog # AAPP28869) |
| Immunogen |
The immunogen for anti-TRMU antibody: synthetic peptide directed towards the C terminal of human TRMU |
| Complete computational species homology data |
TRMU antibody - C-terminal region (ARP48819_P050) |
| Tissue Tool |
Find tissues and cell lines supported to express TRMU.  |
| Reviews and Data |
Computational species homology for TRMU antibody (ARP48819); Product Protocols: TRMU antibody tested with Human Hela Cells (ARP48819_P050) |
| Homology Short |
Bovine, Guinea pig, Pig, Rabbit, Rat, Dog, Horse |
| Observed Species Reactivity |
Human, Mouse, Rat, Bovine, Dog |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Bovine: 100%; Guinea pig: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Dog: 92%; Horse: 92% |
| Image 1 | Human HeLa
 | WB Suggested Anti-TRMU Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate |
|
