Product Number |
ARP48753_P050 |
Product Page |
www.avivasysbio.com/gcat-antibody-c-terminal-region-arp48753-p050.html |
Name |
Gcat Antibody - C-terminal region (ARP48753_P050) |
Protein Size (# AA) |
382 amino acids |
Molecular Weight |
42kDa |
NCBI Gene Id |
26912 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Glycine C-acetyltransferase (2-amino-3-ketobutyrate-coenzyme A ligase) |
Alias Symbols |
Kb, Kbl, AI526977 |
Peptide Sequence |
Synthetic peptide located within the following region: AQYGALVFVDECHATGFLGPTGRGTDELLGVMDQVTIINSTLGKALGGAS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function of this protein remains unknown. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Gcat (ARP48753_P050) antibody |
Blocking Peptide |
For anti-Gcat (ARP48753_P050) antibody is Catalog # AAP48753 (Previous Catalog # AAPS23904) |
Uniprot ID |
E9PWY6 |
Protein Name |
2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial Ensembl ENSMUSP00000131649 |
Protein Accession # |
NP_001155184 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001161712 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
Gcat |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Mouse Pancreas
| WB Suggested Anti-Gcat Antibody Titration: 1.0 ug/ml Positive Control: Mouse Pancreas |
|
|