Product Number |
ARP48740_P050 |
Product Page |
www.avivasysbio.com/hs2st1-antibody-n-terminal-region-arp48740-p050.html |
Name |
HS2ST1 Antibody - N-terminal region (ARP48740_P050) |
Protein Size (# AA) |
356 amino acids |
Molecular Weight |
42kDa |
NCBI Gene Id |
9653 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Heparan sulfate 2-O-sulfotransferase 1 |
Alias Symbols |
NFSRA, dJ604K5.2 |
Peptide Sequence |
Synthetic peptide located within the following region: GLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKLERAIARHEVR |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Xu,D., (2007) J. Biol. Chem. 282 (11), 8356-8367 |
Description of Target |
Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. HS2ST1 is a member of the heparan sulfate biosynthetic enzyme family that transfers sulfate to the 2 position of the iduronic acid residue of heparan sulfate. The disruption of this gene resulted in no kidney formation in knockout embryonic mice, indicating that the absence of this enzyme may interfere with the signaling required for kidney formation. Two alternatively spliced transcript variants that encode different proteins have been found for this gene.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. This gene encodes heparan sulfate 2-O-sulfotransferase, a member of the heparan sulfate biosynthetic enzyme family. This family member transfers sulfate to the 2 position of the iduronic acid residue of heparan sulfate. The disruption of this gene resulted in no kidney formation in knockout embryonic mice, indicating that the absence of this enzyme may interfere with the signaling required for kidney formation. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-HS2ST1 (ARP48740_P050) antibody |
Blocking Peptide |
For anti-HS2ST1 (ARP48740_P050) antibody is Catalog # AAP48740 (Previous Catalog # AAPP28789) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human HS2ST1 |
Uniprot ID |
Q7LGA3 |
Protein Name |
Heparan sulfate 2-O-sulfotransferase 1 |
Sample Type Confirmation |
HS2ST1 is strongly supported by BioGPS gene expression data to be expressed in 721_B |
Protein Accession # |
NP_036394 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_012262 |
Tested Species Reactivity |
Human |
Gene Symbol |
HS2ST1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 77%; Dog: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Human 721_B
| WB Suggested Anti-HS2ST1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: 721_B cell lysateHS2ST1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells |
|