HS2ST1 Antibody - N-terminal region (ARP48740_P050)

Data Sheet
 
Product Number ARP48740_P050
Product Page www.avivasysbio.com/hs2st1-antibody-n-terminal-region-arp48740-p050.html
Name HS2ST1 Antibody - N-terminal region (ARP48740_P050)
Protein Size (# AA) 356 amino acids
Molecular Weight 42kDa
NCBI Gene Id 9653
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Heparan sulfate 2-O-sulfotransferase 1
Alias Symbols NFSRA, dJ604K5.2
Peptide Sequence Synthetic peptide located within the following region: GLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKLERAIARHEVR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Xu,D., (2007) J. Biol. Chem. 282 (11), 8356-8367
Description of Target Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. HS2ST1 is a member of the heparan sulfate biosynthetic enzyme family that transfers sulfate to the 2 position of the iduronic acid residue of heparan sulfate. The disruption of this gene resulted in no kidney formation in knockout embryonic mice, indicating that the absence of this enzyme may interfere with the signaling required for kidney formation. Two alternatively spliced transcript variants that encode different proteins have been found for this gene.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. This gene encodes heparan sulfate 2-O-sulfotransferase, a member of the heparan sulfate biosynthetic enzyme family. This family member transfers sulfate to the 2 position of the iduronic acid residue of heparan sulfate. The disruption of this gene resulted in no kidney formation in knockout embryonic mice, indicating that the absence of this enzyme may interfere with the signaling required for kidney formation.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HS2ST1 (ARP48740_P050) antibody
Blocking Peptide For anti-HS2ST1 (ARP48740_P050) antibody is Catalog # AAP48740 (Previous Catalog # AAPP28789)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HS2ST1
Uniprot ID Q7LGA3
Protein Name Heparan sulfate 2-O-sulfotransferase 1
Sample Type Confirmation

HS2ST1 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Protein Accession # NP_036394
Purification Affinity Purified
Nucleotide Accession # NM_012262
Tested Species Reactivity Human
Gene Symbol HS2ST1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 77%; Dog: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human 721_B
WB Suggested Anti-HS2ST1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysateHS2ST1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com