| Product Number |
ARP48703_P050 |
| Product Page |
www.avivasysbio.com/stk25-antibody-c-terminal-region-arp48703-p050.html |
| Name |
Stk25 Antibody - C-terminal region (ARP48703_P050) |
| Protein Size (# AA) |
426 amino acids |
| Molecular Weight |
48kDa |
| NCBI Gene Id |
373542 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Serine/threonine kinase 25 |
| Alias Symbols |
MGC94619, Stk25 |
| Peptide Sequence |
Synthetic peptide located within the following region: TKKTSFLTELIDRYKRWKSEGHGEESSSEDSDIDGEAEDGEQGPIWTFPP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of Stk25 remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Stk25 (ARP48703_P050) antibody |
| Blocking Peptide |
For anti-Stk25 (ARP48703_P050) antibody is Catalog # AAP48703 (Previous Catalog # AAPP28753) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Rat |
| Uniprot ID |
Q6V9V9 |
| Protein Name |
Protein Stk25 Ensembl ENSRNOP00000024487 |
| Protein Accession # |
NP_908938 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_184049 |
| Tested Species Reactivity |
Rat |
| Gene Symbol |
Stk25 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100% |
| Image 1 | Rat Heart
 | WB Suggested Anti-Stk25 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Rat Heart |
|
|
