| Product Number |
ARP48601_P050 |
| Product Page |
www.avivasysbio.com/ard1b-antibody-middle-region-arp48601-p050.html |
| Name |
Ard1b Antibody - middle region (ARP48601_P050) |
| Protein Size (# AA) |
246 amino acids |
| Molecular Weight |
27kDa |
| NCBI Gene Id |
289482 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
N(alpha)-acetyltransferase 11, NatA catalytic subunit |
| Alias Symbols |
Ard1b |
| Peptide Sequence |
Synthetic peptide located within the following region: SAKYVSLHVRKSNRAALHLYSNTLNFQVSEVEPKYYADGEDAYAMKRDLA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
In complex with NAA15, Ard1b displays alpha (N-terminal) acetyltransferase activity. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Naa11 (ARP48601_P050) antibody |
| Blocking Peptide |
For anti-Naa11 (ARP48601_P050) antibody is Catalog # AAP48601 (Previous Catalog # AAPY01558) |
| Uniprot ID |
Q4V8K3 |
| Protein Name |
N-alpha-acetyltransferase 11 |
| Protein Accession # |
NP_001019913 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001024742 |
| Tested Species Reactivity |
Rat |
| Gene Symbol |
Naa11 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100% |
| Image 1 | Rat Lung
 | WB Suggested Anti-Ard1b Antibody
Titration: 1.0 ug/ml
Positive Control: Rat Lung |
|
|
