| Product Number |
ARP48187_P050 |
| Product Page |
www.avivasysbio.com/atp5f1-antibody-n-terminal-region-arp48187-p050.html |
| Name |
Atp5f1 Antibody - N-terminal region (ARP48187_P050) |
| Protein Size (# AA) |
256 amino acids |
| Molecular Weight |
29kDa |
| Subunit |
b, mitochondrial |
| NCBI Gene Id |
11950 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1 |
| Alias Symbols |
Atp5, Atp5f1, C76477 |
| Peptide Sequence |
Synthetic peptide located within the following region: PPLPEYGGKVRLGLIPEEFFQFLYPKTGVTGPYVLGTGLSLYFLSKEIYV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extramembraneous catalytic core, and F0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F0 domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha3beta3 subcomplex and subunit a/ATP6 static relative to the rotary elements. |
| Protein Interactions |
Plcb1; SNCA; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Atp5f1 (ARP48187_P050) antibody |
| Blocking Peptide |
For anti-Atp5f1 (ARP48187_P050) antibody is Catalog # AAPP28696 |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
Q9CQQ7 |
| Protein Name |
ATP synthase subunit b, mitochondrial |
| Protein Accession # |
NP_033855 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_009725 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Atp5f1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93% |
| Image 1 | Mouse Heart
 | WB Suggested Anti-Atp5f1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Mouse Heart |
|
|
