| Product Number |
ARP48042_P050 |
| Product Page |
www.avivasysbio.com/tnni3k-antibody-middle-region-arp48042-p050.html |
| Name |
Tnni3k Antibody - middle region (ARP48042_P050) |
| Protein Size (# AA) |
834 amino acids |
| Molecular Weight |
92kDa |
| NCBI Gene Id |
435766 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
TNNI3 interacting kinase |
| Alias Symbols |
Ca, Cark, D830019J24Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: NLVACDPSRSSGEKDEQTCLMWAYEKGHDAIVTLLKHYKRPQDELPCNEY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Tnni3k (ARP48042_P050) antibody |
| Blocking Peptide |
For anti-Tnni3k (ARP48042_P050) antibody is Catalog # AAP48042 (Previous Catalog # AAPs20809) |
| Uniprot ID |
B2RTJ7 |
| Protein Name |
Serine/threonine-protein kinase TNNI3K |
| Protein Accession # |
NP_796040 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_177066 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Tnni3k |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Mouse Liver
 | WB Suggested Anti-Tnni3k Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Liver |
|
|
