DKK1 Antibody - C-terminal region (ARP48015_T100)

Data Sheet
 
Product Number ARP48015_T100
Product Page www.avivasysbio.com/dkk1-antibody-c-terminal-region-arp48015-t100.html
Name DKK1 Antibody - C-terminal region (ARP48015_T100)
Protein Size (# AA) 266 amino acids
Molecular Weight 29 kDa
NCBI Gene Id 22943
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Dickkopf 1 homolog (Xenopus laevis)
Alias Symbols SK, DKK-1
Peptide Sequence Synthetic peptide located within the following region: CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ai,M., (2005) Mol. Cell. Biol. 25 (12), 4946-4955
Description of Target DKK1 is a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma.This gene encodes a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma.
Protein Interactions KRTAP10-1; LRP6; MDFI; LRP5; DPP4; SMAD9; KREMEN1; CORO1A; CTNNB1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
Datasheets/Manuals Printable datasheet for anti-DKK1 (ARP48015_T100) antibody
Blocking Peptide For anti-DKK1 (ARP48015_T100) antibody is Catalog # AAP48015 (Previous Catalog # AAPS20606)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human DKK1
Uniprot ID O94907
Protein Name Dickkopf-related protein 1
Protein Accession # NP_036374
Purification Protein A purified
Nucleotide Accession # NM_012242
Tested Species Reactivity Human
Gene Symbol DKK1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Image 1

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 2.5 ug/mL of the antibody was used in this experiment.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com