Product Number |
ARP48015_T100 |
Product Page |
www.avivasysbio.com/dkk1-antibody-c-terminal-region-arp48015-t100.html |
Name |
DKK1 Antibody - C-terminal region (ARP48015_T100) |
Protein Size (# AA) |
266 amino acids |
Molecular Weight |
29 kDa |
NCBI Gene Id |
22943 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Dickkopf 1 homolog (Xenopus laevis) |
Alias Symbols |
SK, DKK-1 |
Peptide Sequence |
Synthetic peptide located within the following region: CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ai,M., (2005) Mol. Cell. Biol. 25 (12), 4946-4955 |
Description of Target |
DKK1 is a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma.This gene encodes a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma. |
Protein Interactions |
KRTAP10-1; LRP6; MDFI; LRP5; DPP4; SMAD9; KREMEN1; CORO1A; CTNNB1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
Relative Expression (Western Blot) |
|
|
Datasheets/Manuals |
Printable datasheet for anti-DKK1 (ARP48015_T100) antibody |
Blocking Peptide |
For anti-DKK1 (ARP48015_T100) antibody is Catalog # AAP48015 (Previous Catalog # AAPS20606) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human DKK1 |
Uniprot ID |
O94907 |
Protein Name |
Dickkopf-related protein 1 |
Protein Accession # |
NP_036374 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_012242 |
Tested Species Reactivity |
Human |
Gene Symbol |
DKK1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86% |
Image 1 |
| 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 2.5 ug/mL of the antibody was used in this experiment.
|
|