KIAA0515 Antibody - N-terminal region (ARP47973_P050)

Data Sheet
 
Product Number ARP47973_P050
Product Page www.avivasysbio.com/kiaa0515-antibody-n-terminal-region-arp47973-p050.html
Name KIAA0515 Antibody - N-terminal region (ARP47973_P050)
Protein Size (# AA) 444 amino acids
Molecular Weight 48kDa
NCBI Gene Id 84726
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Proline-rich coiled-coil 2B
Alias Symbols BAT2L, BAT2L1, LQFBS-1, KIAA0515
Peptide Sequence Synthetic peptide located within the following region: ATASQPPESLPQPGLQKSVSNLQKPTQSISQENTNSVPGGPKSWAQLNGK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function remains unknown.
Protein Interactions UBC; Hoxa1; APP; ATXN1L; ATXN1; ATN1; RERE; SIRT7; IRF4; Eif3a; TADA2A; USP11; USP3; EIF3H; EIF3F; EHMT2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PRRC2B (ARP47973_P050) antibody
Blocking Peptide For anti-PRRC2B (ARP47973_P050) antibody is Catalog # AAP47973 (Previous Catalog # AAPS20001)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human KIAA0515
Uniprot ID Q5JSZ5
Sample Type Confirmation

PRRC2B is supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # EAW87968
Purification Affinity Purified
Tested Species Reactivity Human
Gene Symbol PRRC2B
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 93%
Image 1
Human HepG2
WB Suggested Anti-KIAA0515 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysatePRRC2B is supported by BioGPS gene expression data to be expressed in HepG2
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com