ZNF420 Antibody - N-terminal region (ARP47943_P050)

Data Sheet
 
Product Number ARP47943_P050
Product Page www.avivasysbio.com/znf420-antibody-n-terminal-region-arp47943-p050.html
Name ZNF420 Antibody - N-terminal region (ARP47943_P050)
Protein Size (# AA) 688 amino acids
Molecular Weight 80kDa
NCBI Gene Id 147923
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Zinc finger protein 420
Alias Symbols APAK
Peptide Sequence Synthetic peptide located within the following region: LENYSNLVSLDLPSRCASKDLSPEKNTYETELSQWEMSDRLENCDLEESN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)
Description of Target ZNF420 contains 19 C2H2-type zinc fingers and 1 KRAB domain. ZNF420 may be involved in transcriptional regulation.
Protein Interactions CYP4V2; HAX1; TRIM28; TP53; TNFRSF1B; SLC1A7; CYP51A1; CDKN2A; CDC42; CDK2AP1; UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF420 (ARP47943_P050) antibody
Blocking Peptide For anti-ZNF420 (ARP47943_P050) antibody is Catalog # AAP47943 (Previous Catalog # AAPS19306)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF420
Uniprot ID Q8TAQ5
Protein Name Zinc finger protein 420
Protein Accession # NP_653290
Purification Affinity Purified
Nucleotide Accession # NM_144689
Tested Species Reactivity Human
Gene Symbol ZNF420
Predicted Species Reactivity Human, Dog, Horse
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 77%; Horse: 90%; Human: 100%
Image 1
Human 293T
WB Suggested Anti-ZNF420 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com