| Product Number |
ARP47876_P050 |
| Product Page |
www.avivasysbio.com/lab-antibody-n-terminal-region-arp47876-p050.html |
| Name |
lab Antibody - N-terminal region (ARP47876_P050) |
| Protein Size (# AA) |
495 amino acids |
| Molecular Weight |
54kDa |
| NCBI Gene Id |
40817 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Labial |
| Alias Symbols |
BG:DS00004.9, CG1264, Dm lab, Dmel\CG1264, Dmlab, DmLab, EfR9, F121, F24, F90, F90-2, l(3)01241, l(3)84Ac, Lab, LAB, lb |
| Peptide Sequence |
Synthetic peptide located within the following region: MMDVSSMYGNHPHHHHPHANAYDGYSTTTASAANASSYFAPQQHQPHLQL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
lab is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It is required for proper head development. |
| Protein Interactions |
Abd-B; abd-A; Ubx; Antp; Scr; Dfd; pb; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-lab (ARP47876_P050) antibody |
| Blocking Peptide |
For anti-lab (ARP47876_P050) antibody is Catalog # AAP47876 (Previous Catalog # AAPP27320) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Fruit fly |
| Uniprot ID |
P10105 |
| Protein Accession # |
CAA31495 |
| Purification |
Affinity Purified |
| Tested Species Reactivity |
Fruit fly |
| Gene Symbol |
lab |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Fruit fly:100%; |
| Image 1 | Drosophila
 | WB Suggested Anti-lab Antibody Titration: 0.2-1 ug/ml
Positive Control: Drosophila |
|
|
