Product Number |
ARP47876_P050 |
Product Page |
www.avivasysbio.com/lab-antibody-n-terminal-region-arp47876-p050.html |
Name |
lab Antibody - N-terminal region (ARP47876_P050) |
Protein Size (# AA) |
495 amino acids |
Molecular Weight |
54kDa |
NCBI Gene Id |
40817 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Labial |
Alias Symbols |
BG:DS00004.9, CG1264, Dm lab, Dmel\CG1264, Dmlab, DmLab, EfR9, F121, F24, F90, F90-2, l(3)01241, l(3)84Ac, Lab, LAB, lb |
Peptide Sequence |
Synthetic peptide located within the following region: MMDVSSMYGNHPHHHHPHANAYDGYSTTTASAANASSYFAPQQHQPHLQL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
lab is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It is required for proper head development. |
Protein Interactions |
Abd-B; abd-A; Ubx; Antp; Scr; Dfd; pb; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-lab (ARP47876_P050) antibody |
Blocking Peptide |
For anti-lab (ARP47876_P050) antibody is Catalog # AAP47876 (Previous Catalog # AAPP27320) |
Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Fruit fly |
Uniprot ID |
P10105 |
Protein Accession # |
CAA31495 |
Purification |
Affinity Purified |
Tested Species Reactivity |
Fruit fly |
Gene Symbol |
lab |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Fruit fly:100%; |
Image 1 | Drosophila
| WB Suggested Anti-lab Antibody Titration: 0.2-1 ug/ml Positive Control: Drosophila |
|
|