| Product Number |
ARP47825_P050 |
| Product Page |
www.avivasysbio.com/cad-antibody-middle-region-arp47825-p050.html |
| Name |
cad Antibody - middle region (ARP47825_P050) |
| Protein Size (# AA) |
427 amino acids |
| Molecular Weight |
46kDa |
| NCBI Gene Id |
35341 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Caudal |
| Alias Symbols |
38E.19, anon-WO2004063362.83, Cad, CAD, cd, CG1759, Dmel\CG1759, S67 |
| Peptide Sequence |
Synthetic peptide located within the following region: SVSNNNRTSPSKPPYFDWMKKPAYPAQPQPGKTRTKDKYRVVYTDFQRLE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Cad regulates embryonic abdominal segment formation by zygotically activating expression of knirps (kni) and giant (gt). It plays a role in the establishment of the hindgut and in the invagination of the hindgut primordium during gastrulation. These effects on the gut are achieved by acting combinatorially at the posterior of the embryo to activate transcription of different targets, including folded gastrulation (fog), fork head (fkh) and wingless (wg). |
| Protein Interactions |
CG1418; CG32647; CG34168; CkIIalpha; RpS7; CG31140; lsn; CG10032; CG6933; Cp16; CG2199; Khc; CG15706; CG13339; Ef1alpha48D; CG14764; noc; CG44774; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-cad (ARP47825_P050) antibody |
| Blocking Peptide |
For anti-cad (ARP47825_P050) antibody is Catalog # AAP47825 (Previous Catalog # AAPS19005) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Fruit fly |
| Uniprot ID |
P09085 |
| Protein Name |
Homeotic protein caudal |
| Protein Accession # |
NP_599128 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_134301 |
| Tested Species Reactivity |
Fruit fly |
| Gene Symbol |
cad |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Drosophila
 | WB Suggested Anti-cad Antibody Titration: 0.2-1 ug/ml
Positive Control: Drosophila |
|
|
