Product Number |
ARP47815_P050 |
Product Page |
www.avivasysbio.com/npnt-antibody-middle-region-arp47815-p050.html |
Name |
NPNT Antibody - middle region (ARP47815_P050) |
Protein Size (# AA) |
565 amino acids |
Molecular Weight |
62kDa |
NCBI Gene Id |
255743 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Nephronectin |
Alias Symbols |
POEM, EGFL6L |
Peptide Sequence |
Synthetic peptide located within the following region: TTGLTTIAPAASTPPGGITVDNRVQTDPQKPRGDVFIPRQPSNDLFEIFE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Huang,J.T. (2005) Int. J. Mol. Med. 15 (4), 719-724 |
Description of Target |
NPNT is a functional ligand of integrin alpha-8/beta-1 in kidney development. It regulates with integrin alpha-8/beta-1 the expression of GDNF which is essential for kidney development. It may also play a role in the development and function of various tissues, regulating cell adhesion, spreading and survival through the binding of several integrins. |
Protein Interactions |
ITGA8; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-NPNT (ARP47815_P050) antibody |
Blocking Peptide |
For anti-NPNT (ARP47815_P050) antibody is Catalog # AAP47815 (Previous Catalog # AAPS18709) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human NPNT |
Uniprot ID |
Q6UXI9 |
Protein Name |
Nephronectin |
Protein Accession # |
NP_001028219 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001033047 |
Tested Species Reactivity |
Human |
Gene Symbol |
NPNT |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human HepG2
| Host: Rabbit Target Name: NPNT Sample Tissue: Human HepG2 Antibody Dilution: 1.0ug/ml |
|
Image 2 | Hela, 293T
| Host: Rabbit Target: NPNT Positive control (+): Hela (HL) Negative control (-): 293T (2T) Antibody concentration: 3ug/ml |
|
Image 3 | Human RPMI 8226 Whole Cell
| Host: Rabbit Target Name: NPNT Sample Tissue: Human RPMI 8226 Whole Cell Antibody Dilution: 4ug/ml |
|
Image 4 | Human K562 Whole Cell
| Host: Rabbit Target Name: NPNT Sample Tissue: Human K562 Whole Cell Antibody Dilution: 5ug/ml |
|