NPNT Antibody - middle region (ARP47815_P050)

Data Sheet
 
Product Number ARP47815_P050
Product Page www.avivasysbio.com/npnt-antibody-middle-region-arp47815-p050.html
Name NPNT Antibody - middle region (ARP47815_P050)
Protein Size (# AA) 565 amino acids
Molecular Weight 62kDa
NCBI Gene Id 255743
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Nephronectin
Alias Symbols POEM, EGFL6L
Peptide Sequence Synthetic peptide located within the following region: TTGLTTIAPAASTPPGGITVDNRVQTDPQKPRGDVFIPRQPSNDLFEIFE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Huang,J.T. (2005) Int. J. Mol. Med. 15 (4), 719-724
Description of Target NPNT is a functional ligand of integrin alpha-8/beta-1 in kidney development. It regulates with integrin alpha-8/beta-1 the expression of GDNF which is essential for kidney development. It may also play a role in the development and function of various tissues, regulating cell adhesion, spreading and survival through the binding of several integrins.
Protein Interactions ITGA8;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NPNT (ARP47815_P050) antibody
Blocking Peptide For anti-NPNT (ARP47815_P050) antibody is Catalog # AAP47815 (Previous Catalog # AAPS18709)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human NPNT
Uniprot ID Q6UXI9
Protein Name Nephronectin
Protein Accession # NP_001028219
Purification Affinity Purified
Nucleotide Accession # NM_001033047
Tested Species Reactivity Human
Gene Symbol NPNT
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human HepG2
Host: Rabbit
Target Name: NPNT
Sample Tissue: Human HepG2
Antibody Dilution: 1.0ug/ml
Image 2
Hela, 293T
Host: Rabbit
Target: NPNT
Positive control (+): Hela (HL)
Negative control (-): 293T (2T)
Antibody concentration: 3ug/ml
Image 3
Human RPMI 8226 Whole Cell
Host: Rabbit
Target Name: NPNT
Sample Tissue: Human RPMI 8226 Whole Cell
Antibody Dilution: 4ug/ml
Image 4
Human K562 Whole Cell
Host: Rabbit
Target Name: NPNT
Sample Tissue: Human K562 Whole Cell
Antibody Dilution: 5ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com