Product Number |
ARP47802_P050 |
Product Page |
www.avivasysbio.com/hcg-20426-antibody-c-terminal-region-arp47802-p050.html |
Name |
hCG_20426 Antibody - C-terminal region (ARP47802_P050) |
Protein Size (# AA) |
403 amino acids |
Molecular Weight |
42kDa |
NCBI Gene Id |
441869 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Ankyrin repeat domain 65 |
Alias Symbols |
LOC441869, hCG_20426 |
Peptide Sequence |
Synthetic peptide located within the following region: LAAERGHGPTVGLLLSRGASPTLRTQWAEVAQMPEGDLPQALPELGGGEK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function remain unknown. |
Protein Interactions |
HECW2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ANKRD65 (ARP47802_P050) antibody |
Blocking Peptide |
For anti-ANKRD65 (ARP47802_P050) antibody is Catalog # AAP47802 (Previous Catalog # AAPP28639) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human hCG_20426 |
Uniprot ID |
E5RJM6 |
Protein Accession # |
XP_001126121 |
Purification |
Affinity Purified |
Nucleotide Accession # |
XM_001126121 |
Tested Species Reactivity |
Human |
Gene Symbol |
ANKRD65 |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-hCG_20426 Antibody Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysate |
|
|