| Product Number |
ARP47801_P050 |
| Product Page |
www.avivasysbio.com/hcg-20426-antibody-n-terminal-region-arp47801-p050.html |
| Name |
hCG_20426 Antibody - N-terminal region (ARP47801_P050) |
| Protein Size (# AA) |
403 amino acids |
| Molecular Weight |
42kDa |
| NCBI Gene Id |
441869 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Ankyrin repeat domain 65 |
| Alias Symbols |
LOC441869, hCG_20426 |
| Peptide Sequence |
Synthetic peptide located within the following region: MDSQRPEPREEEEEEQELRWMELDSEEALGTRTEGPSVVQGWGHLLQAVW |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function remain unknown. |
| Protein Interactions |
HECW2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ANKRD65 (ARP47801_P050) antibody |
| Blocking Peptide |
For anti-ANKRD65 (ARP47801_P050) antibody is Catalog # AAP47801 (Previous Catalog # AAPY02579) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human hCG_20426 |
| Uniprot ID |
E5RJM6 |
| Protein Accession # |
XP_497648 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
XM_497648 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ANKRD65 |
| Predicted Species Reactivity |
Human, Dog |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 92%; Human: 100% |
| Image 1 | Human Muscle
 | WB Suggested Anti-hCG_20426 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Muscle |
|
|
