ZNF169 Antibody - middle region (ARP47748_P050)

• Product Number: ARP47748_P050
• Name: ZNF169 Antibody - middle region (ARP47748_P050)
• Protein Size (# AA): 603 amino acids
• Molecular Weight: 68kDa
• NCBI Gene Id: 169841
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Zinc finger protein 169
• Alias Symbols: MGC51961
• Peptide Sequence: Synthetic peptide located within the following region: HQRTHTGEKPYLCPECGRRFSQKASLSIHQRKHSGEKPYVCRECGRHFRY
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Blair,I.P., (1998) Genomics 51 (2), 277-281
• Description of Target: ZNF169 may be involved in transcriptional regulation.
• Protein Interactions: KRTAP10-7; CEP70; CCNDBP1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Additional Information: IHC Information: HepG2 cell lysate. Antibody concentration: 0.25 ug/ml. Gel concentration: 12%.
• Blocking Peptide: For anti-ZNF169 (ARP47748_P050) antibody is Catalog # AAP47748 (Previous Catalog # AAPS22412)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF169
• Uniprot ID: A2AGP5
• Protein Name: Zinc finger protein 169
• Protein Accession #: NP_919301
• Purification: Affinity Purified
• Nucleotide Accession #: NM_194320
• Tested Species Reactivity: Human
• Gene Symbol: ZNF169
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 92%; Rat: 92%
• Image 1: Human kidney
  
  Human kidney
• Image 2: Human HepG2
  
  WB Suggested Anti-ZNF169 Antibody Titration: 0.25ug/ml
  Positive Control: HepG2 cell lysate