| Product Number |
ARP47651_P050 |
| Product Page |
www.avivasysbio.com/meis3-antibody-c-terminal-region-arp47651-p050.html |
| Name |
Meis3 Antibody - C-terminal region (ARP47651_P050) |
| Protein Size (# AA) |
378 amino acids |
| Molecular Weight |
45kDa |
| NCBI Gene Id |
361514 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Meis homeobox 3 |
| Alias Symbols |
Mrg2 |
| Peptide Sequence |
Synthetic peptide located within the following region: LAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGASFNPEGQSMAGY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Meis3 (ARP47651_P050) antibody |
| Blocking Peptide |
For anti-Meis3 (ARP47651_P050) antibody is Catalog # AAP47651 (Previous Catalog # AAPP28512) |
| Uniprot ID |
D4A9U2 |
| Protein Name |
Meis1, myeloid ecotropic viral integration site 1 homolog 3 (Mouse) (Predicted) EMBL EDM08335.1 |
| Protein Accession # |
NP_001101942 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001108472 |
| Tested Species Reactivity |
Rat |
| Gene Symbol |
Meis3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 86% |
| Image 1 | Rat Lung
 | WB Suggested Anti-Meis3 Antibody
Titration: 1.0 ug/ml
Positive Control: Rat Lung |
|
|
