| Product Number |
ARP47635_P050 |
| Product Page |
www.avivasysbio.com/c21orf66-antibody-n-terminal-region-arp47635-p050.html |
| Name |
C21orf66 Antibody - N-terminal region (ARP47635_P050) |
| Protein Size (# AA) |
917 amino acids |
| Molecular Weight |
105 kDa |
| NCBI Gene Id |
94104 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
GC-rich sequence DNA-binding factor 1 |
| Alias Symbols |
GCFC, BM020, GCFC1, FSAP105, C21orf66 |
| Peptide Sequence |
Synthetic peptide located within the following region: PGEIPDAAFIHAARKKRQMARELGDFTPHDNEPGKGRLVREDENDASDDE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Olsen,J.V., (2006) Cell 127 (3), 635-648 |
| Description of Target |
Similarity to a transcriptional repressor suggests that C21orf66 is involved in the regulation of transcription. Alternative splicing of this gene results in three transcript variants encoding different isoforms. Additional transcript variants have been described, but their full-length sequences have not been determined. Similarity to a transcriptional repressor suggests that this gene's protein product is involved in the regulation of transcription. Alternative splicing of this gene results in three transcript variants encoding different isoforms. Additional transcript variants have been described, but their full-length sequences have not been determined. |
| Protein Interactions |
UBC; BMI1; rev; HDAC11; SUMO2; Prpf8; Snw1; TERF2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PAXBP1 (ARP47635_P050) antibody |
| Blocking Peptide |
For anti-PAXBP1 (ARP47635_P050) antibody is Catalog # AAP47635 (Previous Catalog # AAPP28492) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human C21orf66 |
| Uniprot ID |
Q9Y5B6 |
| Protein Name |
GC-rich sequence DNA-binding factor 1 |
| Protein Accession # |
NP_037461 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_013329 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PAXBP1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human Muscle
 | WB Suggested Anti-C21orf66 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Muscle |
|
| Image 2 |
 | 25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The peptide sequence is present in a 93 kDa isoform. The protein may be modified by phosphorylation.
|
|
