Product Number |
ARP47632_P050 |
Product Page |
www.avivasysbio.com/znf117-antibody-n-terminal-region-arp47632-p050.html |
Name |
ZNF117 Antibody - N-terminal region (ARP47632_P050) |
Protein Size (# AA) |
483 amino acids |
Molecular Weight |
56kDa |
NCBI Gene Id |
51351 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Zinc finger protein 117 |
Alias Symbols |
HPF9, H-plk |
Peptide Sequence |
Synthetic peptide located within the following region: QCLKTTLSKIFQCNKYVEVFHKISNSNRHKMRHTENKHFKCKECRKTFCM |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
ZNF117 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation. |
Protein Interactions |
UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF117 (ARP47632_P050) antibody |
Blocking Peptide |
For anti-ZNF117 (ARP47632_P050) antibody is Catalog # AAP47632 (Previous Catalog # AAPP28489) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF117 |
Uniprot ID |
Q03924 |
Protein Name |
Zinc finger protein 117 |
Protein Accession # |
NP_056936 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_015852 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF117 |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human HT1080
| WB Suggested Anti-ZNF117 Antibody Titration: 0.2-1 ug/ml Positive Control: HT1080 cell lysate |
| Image 2 | Human Adult Placenta
| Host: Rabbit Target Name: ZNF117 Sample Type: Human Adult Placenta Antibody Dilution: 1.0ug/ml |
| Image 3 | Human Fetal Lung
| Host: Rabbit Target Name: ZNF117 Sample Type: Human Fetal Lung Antibody Dilution: 1.0ug/ml |
|
|