| Product Number |
ARP47601_P050 |
| Product Page |
http://www.avivasysbio.com/anti-pa2g4-antibody-c-terminal-region-arp47601-p050.html |
| Product Name |
PA2G4 antibody - C-terminal region (ARP47601_P050) |
| Size |
50ug |
| Gene Symbol |
PA2G4 |
| Alias Symbols |
EBP1; HG4-1; p38-2G4 |
| Nucleotide Accession# |
NM_006191 |
| Protein Accession# |
NP_006182 |
| Swissprot Id |
Q9UQ80 |
| Protein Size (# AA) |
394 amino acids |
| Molecular Weight |
44kDa |
| Product Format |
Lyophilized powder |
| NCBI Gene Id |
5036 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Purification |
Affinity Purified |
| Official Gene Full Name |
Proliferation-associated 2G4, 38kDa |
| Description |
This is a rabbit polyclonal antibody against PA2G4. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com). |
| Key Reference |
Okada,M., (2007) J. Biol. Chem. 282 (50), 36744-36754 |
| Partner Proteins |
ERBB3, HDAC2, AR, ERBB3, EXOSC5, HDAC2, PRKCA, PRKCB, PRKCG, RB1, SIN3A, SUMO4, AR, ATR, ERBB3, HDAC2, MTOR, RB1, SGK1, USP39 |
| Description of Target |
PA2G4 is an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases. This protein has been implicated in growth inhibition and the induction of differentiation of human cancer cells.This gene encodes an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases. This protein has been implicated in growth inhibition and the induction of differentiation of human cancer cells. Six pseudogenes, located on chromosomes 3, 6, 9, 18, 20 and X, have been identified. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Blocking Peptide |
For anti-PA2G4 antibody is Catalog # AAP47601 (Previous Catalog # AAPP28459) |
| Immunogen |
The immunogen for anti-PA2G4 antibody: synthetic peptide directed towards the C terminal of human PA2G4 |
| Reconstitution and Storage |
Add 50 μl of distilled water. Final anti-PA2G4 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Complete computational species homology data |
PA2G4 antibody - C-terminal region (ARP47601_P050) |
| Lead Time |
Domestic: within 24 hours delivery
International: 3-5 business days |
| Tissue Tool |
Find tissues and cell lines supported to express PA2G4.  |
| Peptide Sequence |
Synthetic peptide located within the following region: LLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQ |
| Reviews and Data |
Computational species homology for PA2G4 antibody (ARP47601); Product Protocols: PA2G4 antibody tested with Human Hepg2 Cells (ARP47601_P050) |
| Homology Short |
African clawed frog, Bovine, Dog, Guinea pig, Horse, Human, Mouse, Pig, Rat, Zebrafish |
| Observed Species Reactivity |
Human, Mouse, Rat, Dog, African clawed frog, Bovine, Zebrafish |
| Application |
WB, IHC
|
| Predicted Homology Based on Immunogen Sequence |
African clawed frog: 100%; Bovine: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 85% |
| Image 1 | Human HepG2
 | WB Suggested Anti-PA2G4 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate |
|
| Image 2 | Human Lung
 | Lung, respiratory epithelium |
|
