CREBZF Antibody - middle region (ARP47526_P050)

Data Sheet
 
Product Number ARP47526_P050
Product Page www.avivasysbio.com/crebzf-antibody-middle-region-arp47526-p050.html
Name CREBZF Antibody - middle region (ARP47526_P050)
Protein Size (# AA) 354 amino acids
Molecular Weight 37kDa
NCBI Gene Id 58487
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name CREB/ATF bZIP transcription factor
Alias Symbols ZF, SMILE
Peptide Sequence Synthetic peptide located within the following region: AAAARLNRLKKKEYVMGLESRVRGLAAENQELRAENRELGKRVQALQEES
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Misra,V., (2005) J. Biol. Chem. 280 (15), 15257-15266
Description of Target CREBZF strongly activates transcription when bound to HCFC1. CREBZF suppresses the expression of HSV proteins in cells infected with the virus in a HCFC1-dependent manner. It also suppresses the HCFC1-dependent transcriptional activation by CREB3 and redu
Protein Interactions TTC23; CTNNBL1; ACYP2; TP53; CREBZF; XBP1; NFE2L1; ATF6B; ATF4; HCFC1; ZNF512B; CREB3L3; PPARGC1A; ELAVL1; UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CREBZF (ARP47526_P050) antibody
Blocking Peptide For anti-CREBZF (ARP47526_P050) antibody is Catalog # AAP47526 (Previous Catalog # AAPP28363)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CREBZF
Uniprot ID Q9NS37
Protein Name CREB/ATF bZIP transcription factor
Protein Accession # NP_001034707
Purification Affinity Purified
Nucleotide Accession # NM_001039618
Tested Species Reactivity Human
Gene Symbol CREBZF
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB, IHC
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 75%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%
Image 1
Human Stomach
WB Suggested Anti-CREBZF Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Stomach
Image 2
Human testis tissue
Rabbit Anti-CREBZF Antibody
Catalog Number: ARP47526_P050
Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue
Observed Staining: Cytoplasm in Leydig cells
Primary Antibody Concentration: N/A
Other Working Concentrations: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com