| Product Number |
ARP47221_P050 |
| Product Page |
www.avivasysbio.com/a4gnt-antibody-c-terminal-region-arp47221-p050.html |
| Name |
A4GNT Antibody - C-terminal region (ARP47221_P050) |
| Protein Size (# AA) |
340 amino acids |
| Molecular Weight |
39kDa |
| NCBI Gene Id |
51146 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Alpha-1,4-N-acetylglucosaminyltransferase |
| Alias Symbols |
alpha4GnT |
| Peptide Sequence |
Synthetic peptide located within the following region: NISFLHPQRFYPISYREWRRYYEVWDTEPSFNVSYALHLWNHMNQEGRAV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ishizone,S., (2006) Cancer Sci. 97 (2), 119-126 |
| Description of Target |
A4GNT is a protein from the glycosyltransferase 32 family. The enzyme catalyzes the transfer of N-acetylglucosamine (GlcNAc) to core 2 branched O-glycans. It forms a unique glycan, GlcNAcalpha1-->4Galbeta-->R and is largely associated with the Golgi apparatus membrane.This gene encodes a protein from the glycosyltransferase 32 family. The enzyme catalyzes the transfer of N-acetylglucosamine (GlcNAc) to core 2 branched O-glycans. It forms a unique glycan, GlcNAcalpha1-->4Galbeta-->R and is largely associated with the Golgi apparatus membrane. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-A4GNT (ARP47221_P050) antibody |
| Blocking Peptide |
For anti-A4GNT (ARP47221_P050) antibody is Catalog # AAP47221 (Previous Catalog # AAPP27991) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human A4GNT |
| Uniprot ID |
Q9UNA3 |
| Protein Name |
Alpha-1,4-N-acetylglucosaminyltransferase |
| Protein Accession # |
NP_057245 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_016161 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
A4GNT |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 93%; Guinea Pig: 92%; Horse: 79%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 93%; Rat: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-A4GNT Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate |
|
|
