UNC84B Antibody - C-terminal region (ARP47148_P050)

• Product Number: ARP47148_P050
• Name: UNC84B Antibody - C-terminal region (ARP47148_P050)
• Protein Size (# AA): 442 amino acids
• Molecular Weight: 48kDa
• NCBI Gene Id: 25777
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Sad1 and UNC84 domain containing 2
• Alias Symbols: UNC84B
• Peptide Sequence: Synthetic peptide located within the following region: CWAFQGPQGFAVVRLSARIRPTAVTLEHVPKALSPNSTISSAPKDFAIFG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The function remains unknown.
• Protein Interactions: FBXW11; NRM; BTRC; UBC; WHSC1; RPS20; RAB5B; RAB5A; TP53BP1; C9orf3; SYNE1; SYNE2; AGO3; USP20; HGS; RAB5C;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-SUN2 (ARP47148_P050) antibody is Catalog # AAP47148 (Previous Catalog # AAPP27923)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human UNC84B
• Uniprot ID: Q6NT72
• Protein Name: UNC84B protein EMBL AAH69253.1
• Sample Type Confirmation:

  SUN2 is supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: AAH69253
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001199579
• Tested Species Reactivity: Human
• Gene Symbol: SUN2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-UNC84B Antibody Titration: 0.2-1 ug/ml
  Positive Control: HepG2 cell lysateSUN2 is supported by BioGPS gene expression data to be expressed in HepG2