Product Number |
ARP47146_P050 |
Product Page |
www.avivasysbio.com/lrrc8b-antibody-n-terminal-region-arp47146-p050.html |
Name |
LRRC8B Antibody - N-terminal region (ARP47146_P050) |
Protein Size (# AA) |
803 amino acids |
Molecular Weight |
92kDa |
NCBI Gene Id |
23507 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Leucine rich repeat containing 8 family, member B |
Alias Symbols |
TALRRP, TA-LRRP |
Peptide Sequence |
Synthetic peptide located within the following region: PSTSSRLEHFVAILHKCFDSPWTTRALSETVAEQSVRPLKLSKSKILLSS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Kubota,K., FEBS Lett. 564 (1-2), 147-152 (2004) |
Description of Target |
The exact function of LRRC8B remains unknown. |
Protein Interactions |
CUL3; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-LRRC8B (ARP47146_P050) antibody |
Blocking Peptide |
For anti-LRRC8B (ARP47146_P050) antibody is Catalog # AAP47146 (Previous Catalog # AAPP27921) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC8B |
Uniprot ID |
Q6P9F7 |
Protein Name |
Leucine-rich repeat-containing protein 8B |
Protein Accession # |
NP_056165 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_015350 |
Tested Species Reactivity |
Human |
Gene Symbol |
LRRC8B |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100% |
Image 1 | Human Stomach
| WB Suggested Anti-LRRC8B Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human Stomach |
|
|