LRRC8B Antibody - N-terminal region (ARP47146_P050)

Data Sheet
 
Product Number ARP47146_P050
Product Page www.avivasysbio.com/lrrc8b-antibody-n-terminal-region-arp47146-p050.html
Name LRRC8B Antibody - N-terminal region (ARP47146_P050)
Protein Size (# AA) 803 amino acids
Molecular Weight 92kDa
NCBI Gene Id 23507
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Leucine rich repeat containing 8 family, member B
Alias Symbols TALRRP, TA-LRRP
Peptide Sequence Synthetic peptide located within the following region: PSTSSRLEHFVAILHKCFDSPWTTRALSETVAEQSVRPLKLSKSKILLSS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kubota,K., FEBS Lett. 564 (1-2), 147-152 (2004)
Description of Target The exact function of LRRC8B remains unknown.
Protein Interactions CUL3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-LRRC8B (ARP47146_P050) antibody
Blocking Peptide For anti-LRRC8B (ARP47146_P050) antibody is Catalog # AAP47146 (Previous Catalog # AAPP27921)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC8B
Uniprot ID Q6P9F7
Protein Name Leucine-rich repeat-containing protein 8B
Protein Accession # NP_056165
Purification Affinity Purified
Nucleotide Accession # NM_015350
Tested Species Reactivity Human
Gene Symbol LRRC8B
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Image 1
Human Stomach
WB Suggested Anti-LRRC8B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Stomach
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com