| Product Number |
ARP47131_P050 |
| Product Page |
www.avivasysbio.com/minar1-antibody-c-terminal-region-arp47131-p050.html |
| Name |
MINAR1 Antibody - C-terminal region (ARP47131_P050) |
| Protein Size (# AA) |
916 amino acids |
| Molecular Weight |
103kDa |
| NCBI Gene Id |
23251 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
membrane integral NOTCH2 associated receptor 1 |
| Alias Symbols |
UBTOR, KIAA1024 |
| Peptide Sequence |
Synthetic peptide located within the following region: DNKDWHRKSKEADRQYDIPPQHRLPKQPKDGFLVEQVFSPHPYPASLKAH |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Nakajima,D., (2002) DNA Res. 9 (3), 99-106 |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MINAR1 (ARP47131_P050) antibody |
| Blocking Peptide |
For anti-MINAR1 (ARP47131_P050) antibody is Catalog # AAP47131 (Previous Catalog # AAPP27907) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human KIAA1024 |
| Uniprot ID |
Q9UPX6 |
| Protein Name |
major intrinsically disordered Notch2-binding receptor 1; UPF0258 protein KIAA1024 |
| Protein Accession # |
NP_056021 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_015206 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
MINAR1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100% |
| Image 1 | Human Brain
 | WB Suggested Anti-KIAA1024 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain |
|
|
