| Product Number |
ARP47012_P050 |
| Product Page |
www.avivasysbio.com/mtch1-antibody-middle-region-arp47012-p050.html |
| Name |
Mtch1 Antibody - middle region (ARP47012_P050) |
| Protein Size (# AA) |
389 amino acids |
| Molecular Weight |
41kDa |
| NCBI Gene Id |
294313 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Mitochondrial carrier 1 |
| Alias Symbols |
Mtch1 |
| Peptide Sequence |
Synthetic peptide located within the following region: MSNALSTVTRGSMKKVFPPDEIEQVSNKDDMKTSLKKVVKETSYEMMMQC |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
MTCH1 is a potential mitochondrial transporter. It may play a role in apoptosis. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Mtch1 (ARP47012_P050) antibody |
| Blocking Peptide |
For anti-Mtch1 (ARP47012_P050) antibody is Catalog # AAP47012 (Previous Catalog # AAPP27813) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Rat |
| Uniprot ID |
B0BN30 |
| Protein Name |
Mtch1 protein EMBL AAI58662.1 |
| Protein Accession # |
NP_001094303 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001100833 |
| Tested Species Reactivity |
Rat |
| Gene Symbol |
Mtch1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100% |
| Image 1 | Rat Heart
 | WB Suggested Anti-Mtch1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Rat Heart |
|
|
