Product Number |
ARP47012_P050 |
Product Page |
www.avivasysbio.com/mtch1-antibody-middle-region-arp47012-p050.html |
Name |
Mtch1 Antibody - middle region (ARP47012_P050) |
Protein Size (# AA) |
389 amino acids |
Molecular Weight |
41kDa |
NCBI Gene Id |
294313 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Mitochondrial carrier 1 |
Alias Symbols |
Mtch1 |
Peptide Sequence |
Synthetic peptide located within the following region: MSNALSTVTRGSMKKVFPPDEIEQVSNKDDMKTSLKKVVKETSYEMMMQC |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
MTCH1 is a potential mitochondrial transporter. It may play a role in apoptosis. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Mtch1 (ARP47012_P050) antibody |
Blocking Peptide |
For anti-Mtch1 (ARP47012_P050) antibody is Catalog # AAP47012 (Previous Catalog # AAPP27813) |
Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Rat |
Uniprot ID |
B0BN30 |
Protein Name |
Mtch1 protein EMBL AAI58662.1 |
Protein Accession # |
NP_001094303 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001100833 |
Tested Species Reactivity |
Rat |
Gene Symbol |
Mtch1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100% |
Image 1 | Rat Heart
| WB Suggested Anti-Mtch1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: Rat Heart |
|
|